Afina

Download app

AppleWindows
EN
G2
4.7
ExcellentTrustpilot

The Antidetect Browser Powering 1.5M+ Profiles Every Day

5M+ isolated browser sessions run on Afina every day. Manage profiles, build no-code automations, or run custom Node.js modules — all in one platform.

Native UDP over SOCKS5 for QUIC / HTTP/3 — no real IP leaks. Antidetect Browser UDP & WebRTC Leak Test →

Accounts
Extensions
Scripts
Tasks
Synchronizer

Create scenarios from actions and conditions: page transitions, clicks, waits, checks, branching. Use the visual editor or enhance logic with your own code.

Afina — More Than Antidetect

Afina combines antidetect, automation, and development in one product — without workarounds or third-party services.

Next-Generation Antidetect

Real device fingerprints, not generated values. Each profile looks like a real user.

Antidetect feature 1

Automation Without Code

Create scenarios in a visual editor — transitions, clicks, waits, checks, and branching.

Antidetect feature 2

Node.js Without Limits

Use any npm libraries and write your own modules of any complexity.

Antidetect feature 3

Everything Inside Afina

Databases, email, triggers, logic, reports — without buying IDE and external services.

Antidetect feature 4

Telegram Management

Run scenarios and get reports directly in Telegram — even without access to your computer.

Antidetect feature 5

Scaling Without Pain

Databases, email, triggers, logic, reports — without buying IDE and external services.

Antidetect feature 6

Foundation of Stable Work and Everyday Automation

Stable Profile Identification

Stable Profile Identification

Smart fingerprints ensure stable profile operation and reduce the risk of blocks even on complex platforms.

Advanced Network Capabilities

Advanced Network Capabilities

Full support for SOCKS5 proxies and UDP traffic — for scenarios where regular browsers fail.

Predictable Performance Under Load

Predictable Performance Under Load

Architecture designed for long sessions, parallel processes, and stable behavior without failures.

Less Routine — More Results

Less Routine — More Results

Ready-made scenarios, automation, and reusable settings speed up work and eliminate unnecessary actions.

Why You Can Trust Afina?_

We protect your online data through multiple security measures.

  • Account Protection

    A massive range of fingerprint parameters allows for custom configuration, enabling easy simulation of real environments based on business needs and providing full protection for multiple accounts.

    WINIP: 132.87.3…
    WINIP: 22.76.87…
  • Zero-Knowledge Encryption

    Full client-side encryption built on a Zero-Knowledge architecture. The same AES-256, RSA and SHA-512 protocols - but the encryption key never leaves your device, so no one, not even us, can read your data. The strongest protection possible.

    550E800AFINA-41D4-A716-446655440000-A0899594-7F0C-468BAFINA-DDAED058768-7D2A877C-F13B-495D-6E7-8ECD9066
  • Industry-leading Anonymity

    Afina bypasses renowned detection tools, including Pixelscan, CreepJS, and other authoritative platforms.

    WebRTCProhibit
    WebGL ImageRandom
    WebGL InfoCustom
    CanvasCustom

Complete Platform Tools Set

Real Fingerprints

Anti-Detect Core

QUIC / HTTP3

Proxy Control

Extensions Hub

Profile Vault

Encrypted Backup

Profiles Manager

Local API

Databases

Cookie Import

Task Calendar

Task Manager

Email Manager

Real Fingerprints

Anti-Detect Core

QUIC / HTTP3

Proxy Control

Extensions Hub

Profile Vault

Encrypted Backup

Profiles Manager

Local API

Databases

Cookie Import

Task Calendar

Task Manager

Email Manager

Automation Flows

Scripts Engine

Synchronizer

Data Isolation

Session Integrity

Anti-Leak Protection

Advanced Config

Multi-Device Sync

Fingerprint DB

Integrations

Triggers

Noise Injection

Automation Flows

Scripts Engine

Synchronizer

Data Isolation

Session Integrity

Anti-Leak Protection

Advanced Config

Multi-Device Sync

Fingerprint DB

Integrations

Triggers

Noise Injection

Afina Club

Discord icon

closed automation community

Ready scripts and Scenarios

Automation examples

Support and discussions

Early access to new features

Discord

Flexible Plans for Any Task

Choose the number of profiles and connect automation when needed.

Profiles

Profiles

Choose the required number of isolated profiles for working with accounts.

Automation

Automation

Connect visual scenarios, scripts, databases, and triggers.

Scaling

Scaling

Use synchronization and automation for unlimited growth.

Automation is optional. Connect it only when you need it.

Data Security and Reliability

We build Afina as a closed and secure environment for working with accounts, automation, and teams — with no compromises on security.

Data Encryption and Protection

Data Encryption and Protection

All sensitive data is transmitted and stored in encrypted form

  • Encryption in transit and at rest

  • Modern security protocols

  • Protection for every session and action

This reduces the risk of leaks and interceptions

Profile Isolation

Profile Isolation

Each profile operates in its own isolated environment

  • Unique fingerprints

  • Separated storage

  • No cross-session intersections

This reduces the risk of bans and correlations

Full Control and Privacy

Full Control and Privacy

You control the data — we don't have access to it

  • No access to your accounts

  • We don't share data with third parties

  • Minimal logging for stable operation

This reduces the risk of disclosure and unnecessary traces.

An antidetect browser under your brand

Afina Enterprise White Label: launch your own browser product on a ready platform — Afina maintains the core, you own the customers and the revenue.

Branded appsWindows and macOS apps with your name, logo and domains.
Dedicated infrastructureSeparate backend, database, admin panel and API for your project.
Your plans and paymentsYou set the prices and connect your own payment system.

Launch — from $10,000 · Support — from $5,000 / month

Safeguarding Your Business Across 100+ Platforms

Afina has comprehensively passed multi-scenario business testing and supports over 100 platforms, ensuring stable and efficient business operations.

nortonbitdefendermcafeekasperskyavira

Trusted & Secure Anti-Detection Browser

D-U-N-S RegisteredNo. 243331718
Widevine DRMDRM support
Built on TauriNative desktop architecture
GDPR-alignedPrivacy-first data handling

Real-time Security Reputation

scamadviserVerified Safe by Multiple Security Engineshttps://www.scamadviser.com/
apivoidNo threats detected across security vendorshttps://www.apivoid.com/

We Protect Every Platform You Use

Tailored for Business Excellence

PayPal logo
TikTok logo
Amazon logo
Shopify logo
Meta logo
Etsy logo
eBay logo
Temu logo
AliExpress logo
Payoneer logo
Facebook logo
Lazada logo
Microsoft logo
Shopee logo
WorldFirst logo
Rakuten logo
Linio logo
ManoMano logo
Twitter logo
Jumia logo

Users About Afina

Andrew Alisov

Andrew Alisov

Trustpilot

Excellent antidetect browser with great automation features I’ve been using Afina for some time now, and it’s been a great experience. The browser is stable, fingerprints are generated accurately, and the interface is very easy to work with. One of the biggest advantages for me is that Afina supports automation - it saves a lot of time and makes workflow much smoother. Their support team on Discord is also outstanding: fast, friendly, and actually helpful when you need real assistance, not just canned replies. Overall, a reliable and well-thought-out product. Definitely recommended.

View More

C

Chris D.

G2

MCP Server great feature What do you like best about Afina Browser? What I like most is the MCP server. I use it all the time because it lets me work with Afina through an AI agent instead of constantly opening the browser and doing everything manually. I can ask it to work with profiles, start browsers, run scripts, check proxies or handle tasks for me. It makes automation feel much more natural and saves a lot of time in my daily workflow. Also about pricing, its fine What do you dislike about Afina Browser? The only thing I found a bit difficult was getting used to MCP at first. There are a lot of tools available, so it took me some time to understand what I could actually automate with it. After using it for a while, I got the hang of it and now I use MCP almost every day What problems is Afina Browser solving and how is that benefiting you? Afina solves a lot of the repetitive work I have with browser profiles and automation. With the MCP server, I don’t even need to work directly in the Afina interface for many tasks. I can use an AI agent to manage profiles, launch browsers, run scripts, check proxies and work with tasks. For example, if I need to run the same automation on a group of profiles, I can just tell the agent what I need instead of manually opening everything and setting it up. This has made my workflow much faster and easier to scale. Support team helps me with MCP setup

View More

Yuliia Voronina

Yuliia Voronina

Trustpilot

The best and easiest automation There are many anti-detect browsers, but I haven't seen such easy automation like this. I don't have technical education, but everything here was so easy that from almost the first days I was able to realize what I planned. Thanks to support, everything was quick and to the point. The anti-detect browser is also top-notch, fast and without problems. I recommend it!

View More

S

Skee K.

G2

Afina Browser Profile Transfer Makes Team Handovers Seamless What do you like best about Afina Browser? The feature I rely on most in Afina Browser is profile transfer. Our work is often divided between several people, so I can finish my part, send the profile to a colleague, and they can pick up the task without rebuilding the environment. The session, browser settings, and account state remain available, which makes handovers between team members much smoother. The interface is organized well, and the transfer process is easy to find even without much onboarding. Profiles run reliably during everyday work, and I have not had problems continuing a session after it was transferred. For a team, this provides strong value because it reduces idle time and lets us use the same accounts more efficiently. Support has also been helpful whenever we needed clarification about the setup or team workflow. What do you dislike about Afina Browser? After last update as for me team fixed all small things and i dont have any dislikes What problems is Afina Browser solving and how is that benefiting you? I appreciate that Afina includes automation tools, integrations, and MCP support for AI assistants. We have only started testing these options, but they could help us automate part of the profile handover and routine account management later. In our job on office factory its really help

View More

Vladyslav K

Vladyslav K

Trustpilot

Reliable Tool With Great Support and a Strong Community I’ve been using Afina since the very beginning, and my overall experience has been consistently positive. The tool does exactly what it promises, updates always arrive on time, and everything runs safely on my own PC rather than remote servers — which gives me extra peace of mind. The support team is responsive and helpful, and the community around the project is active and constructive. There’s still room to grow, but Afina has been a reliable part of my workflow and continues to improve.

View More

M

Michelle A.

G2

Afina Makes Managing Multiple Crypto Accounts Fast and Effortless What do you like best about Afina Browser? What I like most about Afina is how useful it is for my crypto work. I use it for different testnets, airdrop campaigns, and trading, where I often need separate browser profiles with different proxies and cookies. I can keep different accounts isolated and switch between them quickly without mixing sessions. It makes managing multiple crypto accounts much easier and saves a lot of time compared to doing everything in a regular browser. What do you dislike about Afina Browser? At first, I found the scripting part a little difficult because I wasn’t used to how everything was structured in Afina. It took some time to understand how to build and run the scripts, but after getting familiar with it, it became much easier. Now I can use scripts for a lot of repetitive tasks in my crypto workflow What problems is Afina Browser solving and how is that benefiting you? Afina solved a big problem for me in crypto because I often work with many accounts for testnets, airdrops, and different campaigns. Managing everything manually was taking a lot of time. Once I started learning how to write scripts in Afina and automate repetitive actions, my workflow as a crypto airdrop hunter became much faster. I can automate routine tasks, run them across different profiles, and spend more time on finding new opportunities instead of doing the same actions manually. It made a pretty big difference to my daily work. For this price its best product on market

View More

Daniil Kostin

Daniil Kostin

Trustpilot

I am using Afina for a few months already. The setup is easy, design is convenient, support team very responsive and helpful. I recommend using Afina for large teams because Afina don't have limit on accounts amount. Especially i want to note Afina's founder Mykyta which is ill about your user experience. He is also always developing new features and killer fitches which no one has on the market. GL

View More

S

Stacey S.

G2

Mobile Fingerprints in Afina: A Huge Win for Managing Multiple Android Game Setups What do you like best about Afina Browser? What I like most in the latest Afina version is the addition of mobile fingerprints. This was especially useful for my work because I manage many Android devices for different mobile games, and previously I had to keep a lot of this setup across separate devices. The profiles are also easy to organize and launch, and the interface makes it clear which environment I am working with. I am still adjusting some of my older setups to the new workflow, but so far the mobile fingerprint feature has solved a real problem for how I work with Android games. What do you dislike about Afina Browser? Nothing to say, i am satisfied with afina What problems is Afina Browser solving and how is that benefiting you? Now I have configured the mobile environments I need inside Afina and can work with my game accounts from one place. Each profile has its own settings, so it is much easier to organize accounts and switch between them without constantly going back to different phones. For me, this is one of the most practical updates because it has simplified a workflow that used to depend heavily on physical Android devices The UI is simple, profiles launch quickly, and integrations help keep everything in one place. The price feels fair for the amount of tools included, and support helped me with the initial setup. I also like having automation and MCP/AI features available for more advanced workflows later

View More

Maksym Andronik

Maksym Andronik

Trustpilot

The best tool for automation 1 You can create an unlimited number of profiles 2 The support and community are simply the best ❤️ 3 And of course, the best tool for EASY automation of absolutely anything, anyone can figure it out, even without experience + works with Google extensions 4 The product is very actively developing, new features are constantly added, new scripts, modules, etc. are written

View More

Y

Yuriy S.

G2

Super Secure and Intuitive with Exceptional Support What do you like best about Afina Browser? I just started using Afina Browser to automate UI workflows on products we're building. I really appreciate the very responsive support; whenever I'm stuck or need help building scripts, they're quick to assist. The security is really important to me since it keeps all my data and credentials local, which is crucial for any automation product. Frequent updates show that the product is live, actively developed, and not stagnating, which I find valuable. I'm also impressed by how super easy the initial setup was. Outside of advanced scripting, which I'm still learning, the product is very intuitive. What do you dislike about Afina Browser? I'm still familiarizing myself with some advanced scripting, which is my biggest area of learning. Specifically, synchronizing browser state with some actions that need to be done outside of the browser takes most of my time. What problems is Afina Browser solving and how is that benefiting you? I use Afina Browser to automate UI workflows, pre-configuring multiple workflows to validate and ensure our product isn't degraded.

View More

Anton Duzhenko

Anton Duzhenko

Trustpilot

satisfied with the product I have been using the product for a year and a half, almost since the first day of its launch. I like that it is adapted for cryptocurrency and I have found a lot of useful things for myself. As for the team, they always quickly help you figure things out if you don't understand something. I haven't seen anything like this in similar products before. Overall, I am satisfied.

View More

N

Noah B.

G2

Efficient, Lightweight Browser for Logistics What do you like best about Afina Browser? I like that Afina Browser has a new version on Rust, making its size very small and resource-efficient, even on less powerful company PCs. I appreciate how fast Afina works, with browsers opening quickly, which saves me a lot of time. I also find the integration with my SQL database seamless, and the initial setup was easy, just requiring a login, password, and email. Overall, everything works well for my needs. What do you dislike about Afina Browser? Nothing to say What problems is Afina Browser solving and how is that benefiting you? Afina Browser helps me manage a lot of trucks easily in one place. I like the new Rust version because it makes it run faster without using much PC resources, saving time even on less powerful PCs.

View More

Евгений Коваль

Евгений Коваль

Trustpilot

Great tool for smart automation AFINA is one of the most efficient automation tools I’ve used. Task scheduling, multi-profile control, and script execution work seamlessly. The browser runs stable even under load, and the automation engine is flexible enough for complex workflows. It’s a serious tool for anyone who wants to automate literally everything

View More

V

Viktor S.

G2

Automation Easy and Great Support What do you like best about Afina Browser? Scripts and Support Made Afina Much Easier I like that Afina is not only an antidetect browser, but also a real automation tool. The UI is clear, the script builder is easy to understand, and support helped me write scripts for my own tasks. Integrations like API and MCP also feel useful because you can connect more things and automate more work. Performance is good too profiles open fast, and daily work feels smooth. Overall, my experience with Afina has been very positive. The team helped me understand scripts, showed me what to do, and now I save a lot of time on routine actions. For the price, it offers good value because it combines profiles, automation, support, and AI features in one place. What do you dislike about Afina Browser? Some of the more advanced automation parts take a little time to learn at the beginning, but support and community scripts make the process much easier What problems is Afina Browser solving and how is that benefiting you? That solves me my work because I'm writing the scripts and script doing all my work

View More

Тимофеев Алексей

Тимофеев Алексей

Trustpilot

Compared with others, I am your client! I've probably tried all anti-detect browsers. Afina is truly a good product, one of the market leaders. And if you consider automation, interface convenience, and endless profiles, I don't understand why people use anything else.

View More

S

Solomiia K.

G2

All-in-One, Fast, and Reliable—Afina with Great Support and Automation Options What do you like best about Afina Browser? Everything is collected in one place, and the interface is easy to understand. Profiles open quickly, the browser works reliably, and integrations like the API give me more options for automation and AI tasks. For the price, average prices and very often they have sales I also want to mention the support team. I had internet connection problems and couldn’t figure out what was wrong, but they helped me change the DNS settings on my router. After that, everything started working normally. Onboarding feels much easier when real people respond quickly and explain even technical things in a simple, clear way What do you dislike about Afina Browser? I’ve been using Afina for two years already, and in my opinion I haven’t found any downsides for my work or for my particular use case What problems is Afina Browser solving and how is that benefiting you? It saves me plenty of time

View More

J

Jodee Mils

Trustpilot

A very convenient browser. Huge thanks to the support team for the quick help with adding a worker to my team. They reply super fast to even the silliest questions.

View More

V

Vlad K.

G2

AFINA: Stable, Crash-Free Automation That Scales Across Profiles What do you like best about Afina Browser? AFINA feels stable and easy to work with on a daily basis. Profiles run consistently, the browser doesn’t crash, and automation works without requiring constant manual fixes. It scales well when working with multiple profiles and allows you to focus on tasks instead of technical issues. What do you dislike about Afina Browser? I haven’t noticed any major downsides so far. Everything I needed worked as expected. What problems is Afina Browser solving and how is that benefiting you? AFINA helps manage multiple accounts in a stable and automated way. It simplifies routine workflows and makes scaling much easier.

View More

Sly Fox

Sly Fox

Trustpilot

Wonderful product In my opinion, the best and quite simple to use tool for automation of everything you can do on the internet + anti-detect browser with unlimited number of profiles

View More

D

Daniil P.

G2

Stable anti-detect browser with a helpful community What do you like best about Afina Browser? Afina is reliable for multi-profile work and the setup is straightforward. I also like that they support UDP proxies (useful for certain tools/workflows), and they have an active community that shares real automation tips and ready-to-use practices. Support is responsive when something needs clarification. What do you dislike about Afina Browser? I’d love to see more detailed documentation, although to be fair most things are already pretty intuitive. One feature I really miss is a built-in proxy checker during profile creation, so you can test the proxy right away before saving the profile. What problems is Afina Browser solving and how is that benefiting you? It keeps multiple identities fully separated (profiles/cookies/fingerprints/proxies), so I can run parallel workflows without constant switching or conflicts. UDP proxy support helps in specific setups, and their community makes it easier to learn automation and speed up routine tasks. Overall it saves time, lowers risk of account issues, and keeps work organized.

View More

Company logo

Astro describes Afina Browser as a complete workspace for secure multi-accounting and browser automation The review highlights isolated profiles, consistent fingerprints, flexible proxy management, and protection against accidental real-IP exposure Visual scripts, task groups, AI control through MCP, and bulk operations replace manual account management with structured workflows Astro concludes that Afina provides predictability and easy scaling for teams managing dozens or hundreds of accounts

Company logo

GonzoProxy presents Afina Browser as a structured workspace that transforms multi-accounting from manual routine into a managed process The review highlights isolated profiles, flexible proxy integration, and tools designed for handling accounts at scale Built-in automation helps teams replace repetitive actions with reusable and controlled workflows Afina is positioned as a practical solution for operators who value consistency, organization, and scalable browser operations

Company logo

AffTrends awarded Afina Browser a 5.0 rating in its expert review The publication highlights real-device fingerprints, UDP proxy support, high performance, and advanced automation Visual workflows and Node.js modules are recognized as powerful tools for both simple and complex operations Afina is described as an optimal choice for affiliate marketers who want to launch and scale campaigns quickly and reliably

Company logo

Pixelscan named Afina Browser among the top five anti-detect browsers of 2026 The review highlights reliable UDP-over-SOCKS5 routing for QUIC, HTTP/3, WebTransport, and WebRTC traffic Visual RPA automation, API workflows, synchronization, and MCP-powered AI agents help teams automate operations at scale Flexible roles, groups, tags, and profile permissions make Afina a strong choice for structured team workflows

Learn more

Company logo

Whoerip ranked Afina Browser #2 among the best anti-detect browsers of 2026 The review highlights real-device fingerprints that pass Pixelscan, CreepJS, and similar detection checks Advanced protection prevents real-IP leaks through WebRTC, QUIC, and HTTP/3, while client-side AES-256 encryption keeps sensitive data secure No-code automation, Node.js scripting, API access, and team collaboration make Afina a strong choice for managing accounts at scale

Learn more

Company logo

RichAds ranked Afina Browser #1 in its list of the top anti-detect browsers for 2026 The review highlights isolated profiles, advanced fingerprint and proxy controls, and reliable UDP-over-SOCKS5 routing Visual automation, bulk action syncing, API access, and AI-agent connectivity via MCP are recognized as key advantages Afina is positioned as a powerful workspace for large-scale multi-accounting and team-based operations

Learn more

Company logo

Afina is a powerful yet incredibly user-friendly tool for automation and multi-accounting. The product stands out with stable performance, thoughtful logic, and a high level of anonymity. With the ability to create complex scenarios without programming skills and full control over profiles. Afina truly saves time and enables scaling of any processes.

Learn more

Company logo

Web3-focused automation workspace for airdrops, testnets, and repeatable crypto routines, built for both beginners and power users Block-based algorithms are positioned as a way to reproduce “real user” behavior across browsers, messengers, and decentralized apps The task layer is framed around scale: bulk runs, timing control with delays and schedules, tagging for monitoring, and the ability to intervene during execution Risk reduction is highlighted through the idea that the platform has no direct access to connected wallets, keeping control on the user side

Learn more

Company logo

Consistency-based device modeling keeps each profile aligned to a real CPU/GPU/OS combination to avoid fingerprint contradictions It highlights a common failure mode where HTTP/3 traffic can bypass proxies that don’t support UDP, exposing the real IP A queue-driven runner caps concurrent browsers to fit available RAM/CPU, so hundreds of profiles can execute without crashing the machine Profiles run in separate processes with per-profile logs, auto-skip, and retry logic when a site blocks or errors occur

Learn more

Company logo

Unlimited profiles and simultaneous work, limited only by your hardware, with the full feature set included on every subscription term Clear workspace layout for operations: Accounts/Trash/Groups, Extensions, Proxy tools (connectivity testing and URL-based IP rotation), and Email Credentials/Email controls Built-in utilities for production workflows include “Integration Keys” for API tokens and variables, plus “Import Cookies” to restore sessions without needing passwords

Learn more

Company logo

Local-first anti-detect browser ecosystem with a built-in visual automation builder for multi-account workflows without coding Isolated profiles with realistic fingerprints and full separation of cookies, cache, and network, backed by a real Chromium network stack with UDP, WebRTC, and QUIC and consistent IP across HTTP, DNS, WebRTC, and QUIC Sensitive data is encrypted locally with user-controlled keys, with optional encrypted backups stored in the user’s Google Drive

Learn more

Company logo

Astro describes Afina Browser as a complete workspace for secure multi-accounting and browser automation The review highlights isolated profiles, consistent fingerprints, flexible proxy management, and protection against accidental real-IP exposure Visual scripts, task groups, AI control through MCP, and bulk operations replace manual account management with structured workflows Astro concludes that Afina provides predictability and easy scaling for teams managing dozens or hundreds of accounts

Company logo

GonzoProxy presents Afina Browser as a structured workspace that transforms multi-accounting from manual routine into a managed process The review highlights isolated profiles, flexible proxy integration, and tools designed for handling accounts at scale Built-in automation helps teams replace repetitive actions with reusable and controlled workflows Afina is positioned as a practical solution for operators who value consistency, organization, and scalable browser operations

Company logo

AffTrends awarded Afina Browser a 5.0 rating in its expert review The publication highlights real-device fingerprints, UDP proxy support, high performance, and advanced automation Visual workflows and Node.js modules are recognized as powerful tools for both simple and complex operations Afina is described as an optimal choice for affiliate marketers who want to launch and scale campaigns quickly and reliably

Company logo

Pixelscan named Afina Browser among the top five anti-detect browsers of 2026 The review highlights reliable UDP-over-SOCKS5 routing for QUIC, HTTP/3, WebTransport, and WebRTC traffic Visual RPA automation, API workflows, synchronization, and MCP-powered AI agents help teams automate operations at scale Flexible roles, groups, tags, and profile permissions make Afina a strong choice for structured team workflows

Learn more

Company logo

Whoerip ranked Afina Browser #2 among the best anti-detect browsers of 2026 The review highlights real-device fingerprints that pass Pixelscan, CreepJS, and similar detection checks Advanced protection prevents real-IP leaks through WebRTC, QUIC, and HTTP/3, while client-side AES-256 encryption keeps sensitive data secure No-code automation, Node.js scripting, API access, and team collaboration make Afina a strong choice for managing accounts at scale

Learn more

Company logo

RichAds ranked Afina Browser #1 in its list of the top anti-detect browsers for 2026 The review highlights isolated profiles, advanced fingerprint and proxy controls, and reliable UDP-over-SOCKS5 routing Visual automation, bulk action syncing, API access, and AI-agent connectivity via MCP are recognized as key advantages Afina is positioned as a powerful workspace for large-scale multi-accounting and team-based operations

Learn more

Company logo

Afina is a powerful yet incredibly user-friendly tool for automation and multi-accounting. The product stands out with stable performance, thoughtful logic, and a high level of anonymity. With the ability to create complex scenarios without programming skills and full control over profiles. Afina truly saves time and enables scaling of any processes.

Learn more

Company logo

Web3-focused automation workspace for airdrops, testnets, and repeatable crypto routines, built for both beginners and power users Block-based algorithms are positioned as a way to reproduce “real user” behavior across browsers, messengers, and decentralized apps The task layer is framed around scale: bulk runs, timing control with delays and schedules, tagging for monitoring, and the ability to intervene during execution Risk reduction is highlighted through the idea that the platform has no direct access to connected wallets, keeping control on the user side

Learn more

Company logo

Consistency-based device modeling keeps each profile aligned to a real CPU/GPU/OS combination to avoid fingerprint contradictions It highlights a common failure mode where HTTP/3 traffic can bypass proxies that don’t support UDP, exposing the real IP A queue-driven runner caps concurrent browsers to fit available RAM/CPU, so hundreds of profiles can execute without crashing the machine Profiles run in separate processes with per-profile logs, auto-skip, and retry logic when a site blocks or errors occur

Learn more

Company logo

Unlimited profiles and simultaneous work, limited only by your hardware, with the full feature set included on every subscription term Clear workspace layout for operations: Accounts/Trash/Groups, Extensions, Proxy tools (connectivity testing and URL-based IP rotation), and Email Credentials/Email controls Built-in utilities for production workflows include “Integration Keys” for API tokens and variables, plus “Import Cookies” to restore sessions without needing passwords

Learn more

Company logo

Local-first anti-detect browser ecosystem with a built-in visual automation builder for multi-account workflows without coding Isolated profiles with realistic fingerprints and full separation of cookies, cache, and network, backed by a real Chromium network stack with UDP, WebRTC, and QUIC and consistent IP across HTTP, DNS, WebRTC, and QUIC Sensitive data is encrypted locally with user-controlled keys, with optional encrypted backups stored in the user’s Google Drive

Learn more

Company logo

Astro describes Afina Browser as a complete workspace for secure multi-accounting and browser automation The review highlights isolated profiles, consistent fingerprints, flexible proxy management, and protection against accidental real-IP exposure Visual scripts, task groups, AI control through MCP, and bulk operations replace manual account management with structured workflows Astro concludes that Afina provides predictability and easy scaling for teams managing dozens or hundreds of accounts

Company logo

GonzoProxy presents Afina Browser as a structured workspace that transforms multi-accounting from manual routine into a managed process The review highlights isolated profiles, flexible proxy integration, and tools designed for handling accounts at scale Built-in automation helps teams replace repetitive actions with reusable and controlled workflows Afina is positioned as a practical solution for operators who value consistency, organization, and scalable browser operations

Company logo

AffTrends awarded Afina Browser a 5.0 rating in its expert review The publication highlights real-device fingerprints, UDP proxy support, high performance, and advanced automation Visual workflows and Node.js modules are recognized as powerful tools for both simple and complex operations Afina is described as an optimal choice for affiliate marketers who want to launch and scale campaigns quickly and reliably

Company logo

Pixelscan named Afina Browser among the top five anti-detect browsers of 2026 The review highlights reliable UDP-over-SOCKS5 routing for QUIC, HTTP/3, WebTransport, and WebRTC traffic Visual RPA automation, API workflows, synchronization, and MCP-powered AI agents help teams automate operations at scale Flexible roles, groups, tags, and profile permissions make Afina a strong choice for structured team workflows

Learn more

Company logo

Whoerip ranked Afina Browser #2 among the best anti-detect browsers of 2026 The review highlights real-device fingerprints that pass Pixelscan, CreepJS, and similar detection checks Advanced protection prevents real-IP leaks through WebRTC, QUIC, and HTTP/3, while client-side AES-256 encryption keeps sensitive data secure No-code automation, Node.js scripting, API access, and team collaboration make Afina a strong choice for managing accounts at scale

Learn more

Company logo

RichAds ranked Afina Browser #1 in its list of the top anti-detect browsers for 2026 The review highlights isolated profiles, advanced fingerprint and proxy controls, and reliable UDP-over-SOCKS5 routing Visual automation, bulk action syncing, API access, and AI-agent connectivity via MCP are recognized as key advantages Afina is positioned as a powerful workspace for large-scale multi-accounting and team-based operations

Learn more

Company logo

Afina is a powerful yet incredibly user-friendly tool for automation and multi-accounting. The product stands out with stable performance, thoughtful logic, and a high level of anonymity. With the ability to create complex scenarios without programming skills and full control over profiles. Afina truly saves time and enables scaling of any processes.

Learn more

Company logo

Web3-focused automation workspace for airdrops, testnets, and repeatable crypto routines, built for both beginners and power users Block-based algorithms are positioned as a way to reproduce “real user” behavior across browsers, messengers, and decentralized apps The task layer is framed around scale: bulk runs, timing control with delays and schedules, tagging for monitoring, and the ability to intervene during execution Risk reduction is highlighted through the idea that the platform has no direct access to connected wallets, keeping control on the user side

Learn more

Company logo

Consistency-based device modeling keeps each profile aligned to a real CPU/GPU/OS combination to avoid fingerprint contradictions It highlights a common failure mode where HTTP/3 traffic can bypass proxies that don’t support UDP, exposing the real IP A queue-driven runner caps concurrent browsers to fit available RAM/CPU, so hundreds of profiles can execute without crashing the machine Profiles run in separate processes with per-profile logs, auto-skip, and retry logic when a site blocks or errors occur

Learn more

Company logo

Unlimited profiles and simultaneous work, limited only by your hardware, with the full feature set included on every subscription term Clear workspace layout for operations: Accounts/Trash/Groups, Extensions, Proxy tools (connectivity testing and URL-based IP rotation), and Email Credentials/Email controls Built-in utilities for production workflows include “Integration Keys” for API tokens and variables, plus “Import Cookies” to restore sessions without needing passwords

Learn more

Company logo

Local-first anti-detect browser ecosystem with a built-in visual automation builder for multi-account workflows without coding Isolated profiles with realistic fingerprints and full separation of cookies, cache, and network, backed by a real Chromium network stack with UDP, WebRTC, and QUIC and consistent IP across HTTP, DNS, WebRTC, and QUIC Sensitive data is encrypted locally with user-controlled keys, with optional encrypted backups stored in the user’s Google Drive

Learn more

Awards

Recognition we've received from our customers and review platforms

Users Love Us
People Love Us — Trustpilot
Customers Love Us — SourceForge
High Achiever Winter 2026 — SourceForge
Top Performer Winter 2026 — SourceForge
Leader Winter 2026 — SourceForge

FAQs

Have questions? We're here to help.

Online Support Available

The Antidetect browser Afina.io is a program that hides your identity on the internet by changing device data, such as IP address, browser fingerprints, and other parameters.

Afina.io is necessary for those who work with multi-accounts, engage in traffic arbitrage, manage advertising campaigns, or want to increase anonymity levels online.

The Afina.io program changes unique parameters of your device, such as user agent, IP address, and cookies, making you invisible to tracking and anti-fraud systems.

Yes, the anti-detection browser Afina.io supports API and allows you to create scripts for automating routine tasks.

It allows you to simultaneously manage multiple advertising platform accounts, bypass anti-fraud systems, and efficiently test advertising campaigns.

Using the anti-detection browser Afina.io, you can safely manage multiple accounts on bonus platforms, eliminating the risk of blocks. This helps optimize receiving bonuses on various websites.

Yes, the anti-detection browser Afina.io allows you to create and manage profiles for participating in crypto airdrops, maintaining anonymity and minimizing the likelihood of disqualification due to account data matches.

Text translated: "In the anti-detection browser Afina.io, you can create an unlimited number of profiles

How Anti-Detection Browser Works

The Afina.io anti-detection browser is a tool for working with isolated browser profiles and managing the digital environment. It allows you to customize browser and network settings, creating separate workspaces for different tasks.

This approach helps structure work with multiple accounts, minimize technical overlaps, and maintain configuration stability between sessions.

How Anti-Detection Browser Works

Each profile in Afina.io functions as a separate browser environment. Inside the profile, the following are preserved:

  • cookies and session data
  • localStorage and other local data
  • network parameters
  • user settings

This means that each account operates in its own isolated environment without mixing data with other profiles.

Anti-detection does not mean "invisibility." It refers to the correct configuration of the digital environment and parameter sequence.

Key Features of Afina.io Anti-Detection Browser

1. Isolated Profiles

Each profile is created as an autonomous environment with individual parameters. This allows you to:

  • work with multiple accounts simultaneously
  • separate projects by profiles
  • preserve state between launches
  • run automation in the selected environment

Isolation helps avoid accidental session overlaps and technical conflicts.

2. Browser Parameter Management

In profiles, you can customize parameters such as:

  • user agent
  • screen resolution
  • time zone
  • system language
  • device type

These parameters shape the digital profile configuration and allow you to adapt the environment for different work tasks.

3. Proxy Support

Afina.io supports proxy connections at the profile level. This means that each profile can use its own network connection.

Supported:

  • HTTP
  • HTTPS
  • SOCKS5
  • UDP (when using corresponding proxies)

Proxies are applied both manually and when running automation.

4. Mass Profile Creation and Management

Creating a large number of profiles simplifies working with scalable tasks. For each profile, you can:

  • set individual parameters
  • connect a separate proxy
  • save cookies and history
  • clone settings

This is especially useful for marketing projects, testing, and multi-accounting.

5. Process Automation

Afina.io supports automation through built-in scripts and APIs. This allows you to:

  • perform repetitive actions
  • run processes in parallel
  • structure work scenarios
  • centrally manage tasks

Automation applies to a specific profile and inherits its parameters.

6. Working with Cookies and Session State

Profiles preserve state between launches. This allows you to:

  • return to active sessions
  • avoid reauthorization
  • manually manage cookies
  • import and export data

State stability is important for long-term projects.

Where Anti-Detection Browser is Used

Anti-detection browsers are used in tasks where:

  • working with multiple accounts is required
  • projects are separated by environments
  • website testing in different configurations
  • marketing analytics
  • managing advertising accounts
  • automating routine processes

Afina.io is a technical tool and does not affect the rules of specific platforms.

Why Choose Afina.io

  • isolated profiles
  • flexible network settings
  • support for SOCKS5 and UDP
  • automation and API
  • scalable architecture
  • maintaining configuration stability

Afina.io helps establish structured and predictable work with accounts within the existing platform rules and legislation.

Responsible Use

The anti-detection browser is a tool for organizing the digital environment. Before use, it is recommended to:

  • follow platform rules
  • not exceed reasonable action limits
  • maintain profile parameter stability
  • use separate proxies for different tasks
  • monitor logs and scenario results

Proper configuration and responsible use help minimize technical risks and enhance process manageability.